PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_44515
Common NameKK1_043366, KK1_043367
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 324aa    MW: 36501.5 Da    PI: 6.6281
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_44515genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.4e-54171421128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhPtdeelvv+yLkkkv++ +l++ ++i++vd+yk++Pw+Lp k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+v+s +
  C.cajan_44515  17 LPPGFRFHPTDEELVVHYLKKKVDSIPLPV-SIIADVDLYKFDPWELPGKASFGEEEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVCS-G 110
                    79****************************.89***************8888999***************************************.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    +++vg+kk+Lvfy g+ pkg+ktdW+mheyrl
  C.cajan_44515 111 THKVGVKKSLVFYGGKPPKGVKTDWIMHEYRL 142
                    99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-675176IPR003441NAC domain
PROSITE profilePS5100561.20517176IPR003441NAC domain
PfamPF023651.8E-2818142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
METTDDSSTT SQQQPNLPPG FRFHPTDEEL VVHYLKKKVD SIPLPVSIIA DVDLYKFDPW  60
ELPGKASFGE EEWYFFSPRD RKYPNGARPN RAATSGYWKA TGTDKPVCSG THKVGVKKSL  120
VFYGGKPPKG VKTDWIMHEY RLADTKPNNK PPGCDLGHKK NSLRLDDWVL CRIYKKGNTQ  180
RSPMDHDKDD SMDDMIAEVP SSINVGHMNA RFHLSTSYSG ALLENDRNTL EGVVIGNDLP  240
FATSNNNTLA SKRTLSSLYW NDHDHHEDVV NATSCDHKHF NLDSNGNVTV LRTEENTDNN  300
GSFATLLNHF PQAPYQIQGT NWYG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-73111789170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6573060.0KF657306.1 Glycine max NAC transcription factor (SNAC41) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007133059.10.0hypothetical protein PHAVU_011G148000g
SwissprotQ9LD441e-106NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A151QZA50.0A0A151QZA5_CAJCA; NAC domain-containing protein 18
STRINGGLYMA12G22790.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-101NAC domain containing protein 2